Welcome to Tajirgah
English Language
Azerbaijan AzerbaijanArabic ArabicRussia Russia
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High
Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High

Fashion Women Watch Top Brand Rose Gold Stain Steel Waterproof Date Quartz Ladies Watch Luxury High

Product Code: BKCvvWk
Product Condition: New
$20.99 inc. tax
 Add to Cart
Description
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i