Welcome to Tajirgah
English Language
Azerbaijan AzerbaijanArabic ArabicRussia Russia
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl
European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl

European and American Sexy Black Peach Heart Pendant Gold Stainless steel Necklace Girl's Sexy Neckl

Product Code: 1005003458795754
Product Condition: New
$13.00 inc. tax
 Add to Cart
Description

Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i